PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_22194A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family LBD
Protein Properties Length: 149aa    MW: 16169.2 Da    PI: 6.6161
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_22194AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26057.15.3e-1825349100
                     DUF260  49 lpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                                lp ++r da+sslvyeA+ar+rdPvyG+vg i+ lqqq++ql+ +lal+k+e
  Oropetium_20150105_22194A   2 LPVHQRADAVSSLVYEANARLRDPVYGCVGAISYLQQQVSQLQMQLALAKAE 53 
                                6889********************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089111.402154IPR004883Lateral organ boundaries, LOB
PfamPF031956.9E-16251IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 149 aa     Download sequence    Send to blast
ELPVHQRADA VSSLVYEANA RLRDPVYGCV GAISYLQQQV SQLQMQLALA KAEILCVQMQ  60
QHDDGGQNNY GHYSTAAAPS SKQQQVQQHM DGETFCHSLI TMQNGLTNAL INSPSAHHQQ  120
QLLSSLGSSG STAMMLREAC LKKESLWA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP1008522e-51FP100852.1 Phyllostachys edulis cDNA clone: bphyst013p01, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004978582.11e-48PREDICTED: LOB domain-containing protein 12-like
TrEMBLK3ZJV91e-48K3ZJV9_SETIT; Uncharacterized protein
STRINGSi026864m4e-48(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP88238150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.12e-23LBD family protein